"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q6FSU2"	"{'domain_architectures': 172, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 172}"	"['Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Required for proper protein synthesis within the mitochondrion']"	"GTF1"	"[{'identifier': 'GO:0050567', 'name': 'glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0070681', 'name': 'glutaminyl-tRNAGln biosynthesis via transamidation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0030956', 'name': 'glutamyl-tRNA(Gln) amidotransferase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"GATF_CANGA"	"16d1c902cc41ec9abb7e274b4ac84ba8e5c63d94"	True	False	False	173	"Glutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial"	3	"UP000002428"	"MSRFMIRAVFFRRYTAATVGKPFRNVAEVKQYLAKQTWSIDEILHGEDTGKAAKQGVPTEEEVRKLLALCAFPVEDADLQNSKRILVKQLSFINKLHETSVDDQDKNLDENYARLLPRQNKALTYDDLLKKIDGIKQDEATGEPTGSWDSTGLAKMRKDNYFIVRQGLLKNRK"	"reviewed"	"{'taxId': '284593', 'scientificName': 'Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)', 'fullName': 'Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) (Yeast)'}"