GET /api/protein/reviewed/Q5RCP4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q5RCP4",
"id": "DJC15_PONAB",
"source_organism": {
"taxId": "9601",
"scientificName": "Pongo abelii",
"fullName": "Pongo abelii (Sumatran orangutan)"
},
"name": "DnaJ homolog subfamily C member 15",
"description": [
"Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP. Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9 (By similarity)"
],
"length": 150,
"sequence": "MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAAFAFAGRYAFRIWKPLEQVITETAKKISTPSLSSYYKGGFEKKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH",
"proteome": "UP000001595",
"gene": "DNAJC15",
"go_terms": null,
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dcdb67511752254241a3c74e02af6a487262e284",
"counters": {
"domain_architectures": 697,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 697
}
}
}