"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q5RCP4"	"{'domain_architectures': 697, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 697}"	"['Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP. Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9 (By similarity)']"	"DNAJC15"	""	"DJC15_PONAB"	"dcdb67511752254241a3c74e02af6a487262e284"	True	False	False	150	"DnaJ homolog subfamily C member 15"	2	"UP000001595"	"MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAAFAFAGRYAFRIWKPLEQVITETAKKISTPSLSSYYKGGFEKKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH"	"reviewed"	"{'taxId': '9601', 'scientificName': 'Pongo abelii', 'fullName': 'Pongo abelii (Sumatran orangutan)'}"
