General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q3E731",
        "id": "COX19_YEAST",
        "source_organism": {
            "taxId": "559292",
            "scientificName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
            "fullName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)"
        },
        "name": "Cytochrome c oxidase assembly protein COX19",
        "description": [
            "Assembly factor for cytochrome c oxidase (respiratory chain complex IV, CIV) (PubMed:12171940, PubMed:25926683). Acts as a COX11 chaperone that supports COX11 copper coordination (PubMed:25926683). Cannot compensate for the absence of COX11 (PubMed:25926683)"
        ],
        "length": 98,
        "sequence": "MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYLRCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK",
        "proteome": "UP000002311",
        "gene": "COX19",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}