"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q3E731"	"{'domain_architectures': 0, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Assembly factor for cytochrome c oxidase (respiratory chain complex IV, CIV) (PubMed:12171940, PubMed:25926683). Acts as a COX11 chaperone that supports COX11 copper coordination (PubMed:25926683). Cannot compensate for the absence of COX11 (PubMed:25926683)']"	"COX19"	""	"COX19_YEAST"	""	True	False	98	"Cytochrome c oxidase assembly protein COX19"	1	"UP000002311"	"MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYLRCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK"	"reviewed"	"{'taxId': '559292', 'scientificName': 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)', 'fullName': ""Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)""}"