GET /api/protein/reviewed/P9WNU6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P9WNU6",
        "id": "PAFA_MYCTO",
        "source_organism": {
            "taxId": "83331",
            "scientificName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)",
            "fullName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)"
        },
        "name": "Pup--protein ligase",
        "description": [
            "Catalyzes the covalent attachment of the prokaryotic ubiquitin-like protein modifier Pup to the proteasomal substrate proteins, thereby targeting them for proteasomal degradation. This tagging system is termed pupylation. The ligation reaction involves the side-chain carboxylate of the C-terminal glutamate of Pup and the side-chain amino group of a substrate lysine. PafA is required to confer resistance against the lethal effects of reactive nitrogen intermediates (RNI), antimicrobial molecules produced by activated macrophages and other cell types"
        ],
        "length": 452,
        "sequence": "MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM",
        "proteome": "UP000001020",
        "gene": "pafA",
        "go_terms": [
            {
                "identifier": "GO:0010498",
                "name": "proteasomal protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019941",
                "name": "modification-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016879",
                "name": "ligase activity, forming carbon-nitrogen bonds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fb15860118f237b0124b05585d2f685e46d0a4a6",
        "counters": {
            "domain_architectures": 8673,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8673
        }
    }
}