GET /api/protein/reviewed/P0AAR3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0AAR3",
        "id": "YBAK_ECOLI",
        "source_organism": {
            "taxId": "83333",
            "scientificName": "Escherichia coli (strain K12)",
            "fullName": "Escherichia coli (strain K12)"
        },
        "name": "Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK",
        "description": [
            "Functions in trans to edit the amino acid from incorrectly charged Cys-tRNA(Pro) via a Cys-tRNA(Pro) deacylase activity. May compensate for the lack of Cys-tRNA(Pro) editing by ProRS. Is also able to deacylate Cys-tRNA(Cys), and displays weak deacylase activity in vitro against Gly-tRNA(Gly), as well as, at higher concentrations, some other correctly charged tRNAs. Unlike some of its orthologs it is not able to remove the amino acid moiety from incorrectly charged Ala-tRNA(Pro)"
        ],
        "length": 159,
        "sequence": "MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVYKTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD",
        "proteome": "UP000000625",
        "gene": "ybaK",
        "go_terms": [
            {
                "identifier": "GO:0002161",
                "name": "aminoacyl-tRNA deacylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "740b85485d87094b84b7e66296ac5f060f7a352b",
        "counters": {
            "domain_architectures": 40466,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 40466
        }
    }
}