"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0AAR3"	"{'domain_architectures': 40466, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'pirsf': 1, 'ncbifam': 2, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 40466}"	"['Functions in trans to edit the amino acid from incorrectly charged Cys-tRNA(Pro) via a Cys-tRNA(Pro) deacylase activity. May compensate for the lack of Cys-tRNA(Pro) editing by ProRS. Is also able to deacylate Cys-tRNA(Cys), and displays weak deacylase activity in vitro against Gly-tRNA(Gly), as well as, at higher concentrations, some other correctly charged tRNAs. Unlike some of its orthologs it is not able to remove the amino acid moiety from incorrectly charged Ala-tRNA(Pro)']"	"ybaK"	"[{'identifier': 'GO:0002161', 'name': 'aminoacyl-tRNA deacylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"YBAK_ECOLI"	"740b85485d87094b84b7e66296ac5f060f7a352b"	True	False	False	159	"Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK"	1	"UP000000625"	"MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVYKTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"