General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P00131",
        "id": "CYC3_NITV2",
        "source_organism": {
            "taxId": "882",
            "scientificName": "Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)",
            "fullName": "Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)"
        },
        "name": "Cytochrome c3",
        "description": [
            "Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin"
        ],
        "length": 129,
        "sequence": "MRKLFFCGVLALAVAFALPVVAAPKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE",
        "proteome": "UP000002194",
        "gene": "DVU_3171",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9b5341ad0883d90a99aea37c06a445873153ea8a",
        "counters": {
            "domain_architectures": 1053,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 5,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1053
        }
    }
}