"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P00131"	"{'domain_architectures': 1053, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 5, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1053}"	"['Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin']"	"DVU_3171"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CYC3_NITV2"	"9b5341ad0883d90a99aea37c06a445873153ea8a"	True	False	False	129	"Cytochrome c3"	1	"UP000002194"	"MRKLFFCGVLALAVAFALPVVAAPKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE"	"reviewed"	"{'taxId': '882', 'scientificName': 'Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)', 'fullName': 'Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)'}"