General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "X2FGP7",
        "id": "X2FGP7_CHV16",
        "source_organism": {
            "taxId": "340907",
            "scientificName": "Cercopithecine herpesvirus 16",
            "fullName": "Cercopithecine herpesvirus 16 (CeHV-16)"
        },
        "name": "Cytoplasmic envelopment protein 3",
        "description": [
            "Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery"
        ],
        "length": 95,
        "sequence": "MGVAGSRVGPCCCRRNVLVTDRGETVSLTANEFDAVELESDAGGNFYISPELRVVTQPPTQPPHPRGPPSRGDRHWSRSGRRPDPISDPTPPSVR",
        "proteome": null,
        "gene": "UL11",
        "go_terms": [
            {
                "identifier": "GO:0009653",
                "name": "anatomical structure morphogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019033",
                "name": "viral tegument",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "a33b18f3957fc9c18b4330ba5f97e4f5fa23db7c",
        "counters": {
            "domain_architectures": 110,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 110
        }
    }
}