"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"X2FGP7"	"{'domain_architectures': 110, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'hamap': 1, 'pirsf': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 110}"	"['Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery']"	"UL11"	"[{'identifier': 'GO:0009653', 'name': 'anatomical structure morphogenesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0019033', 'name': 'viral tegument', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"X2FGP7_CHV16"	"a33b18f3957fc9c18b4330ba5f97e4f5fa23db7c"	False	False	False	95	"Cytoplasmic envelopment protein 3"	3	""	"MGVAGSRVGPCCCRRNVLVTDRGETVSLTANEFDAVELESDAGGNFYISPELRVVTQPPTQPPHPRGPPSRGDRHWSRSGRRPDPISDPTPPSVR"	"unreviewed"	"{'taxId': '340907', 'scientificName': 'Cercopithecine herpesvirus 16', 'fullName': 'Cercopithecine herpesvirus 16 (CeHV-16)'}"