General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W9WEK6",
        "id": "W9WEK6_9EURO",
        "source_organism": {
            "taxId": "1182544",
            "scientificName": "Cladophialophora yegresii CBS 114405",
            "fullName": "Cladophialophora yegresii CBS 114405"
        },
        "name": "Ribosomal protein/NADH dehydrogenase domain-containing protein",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 94,
        "sequence": "MATKYAFTQGLRELRFHLSNSGQGSDACRSFLRRAYPTMKHHNPNIPILIREATGVEPKVWARYGYGKEKSESLAGLSDKEIEDKVTTLVKSGE",
        "proteome": "UP000019473",
        "gene": "A1O7_03455",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "852f0a5d90ec90df505ecc00a82e4bf1b3023bd6",
        "counters": {
            "domain_architectures": 10106,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10106
        }
    }
}