"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W9WEK6"	"{'domain_architectures': 10106, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10106}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"A1O7_03455"	""	"W9WEK6_9EURO"	"852f0a5d90ec90df505ecc00a82e4bf1b3023bd6"	True	False	True	94	"Ribosomal protein/NADH dehydrogenase domain-containing protein"	3	"UP000019473"	"MATKYAFTQGLRELRFHLSNSGQGSDACRSFLRRAYPTMKHHNPNIPILIREATGVEPKVWARYGYGKEKSESLAGLSDKEIEDKVTTLVKSGE"	"unreviewed"	"{'taxId': '1182544', 'scientificName': 'Cladophialophora yegresii CBS 114405', 'fullName': 'Cladophialophora yegresii CBS 114405'}"