HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W1QJC5",
"id": "W1QJC5_OGAPD",
"source_organism": {
"taxId": "871575",
"scientificName": "Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1)",
"fullName": "Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast)"
},
"name": "DNA-directed RNA polymerase subunit",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 112,
"sequence": "MLTFCPHCSNMLVVARSEISGSNSFTCPTCPYEFPIDGILVYERKELPRKQVDDVLGGEGAWDNVDQTVTQCPVESCGFDKAYFFQLQIRSADEPMTTFYKCCKCGHRWREN",
"proteome": "UP000008673",
"gene": "HPODL_05122",
"go_terms": [
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a2e5462c097e61b689ed84e14a282df8fd1793e5",
"counters": {
"domain_architectures": 7047,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"smart": 2,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"profile": 1,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7047
}
}
}