"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W1QJC5"	"{'domain_architectures': 7047, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'smart': 2, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7047}"	"['DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates']"	"HPODL_05122"	"[{'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"W1QJC5_OGAPD"	"a2e5462c097e61b689ed84e14a282df8fd1793e5"	True	False	False	112	"DNA-directed RNA polymerase subunit"	3	"UP000008673"	"MLTFCPHCSNMLVVARSEISGSNSFTCPTCPYEFPIDGILVYERKELPRKQVDDVLGGEGAWDNVDQTVTQCPVESCGFDKAYFFQLQIRSADEPMTTFYKCCKCGHRWREN"	"unreviewed"	"{'taxId': '871575', 'scientificName': 'Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1)', 'fullName': 'Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast)'}"