GET /api/protein/UniProt/W0HLW2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "W0HLW2",
"id": "W0HLW2_9GAMM",
"source_organism": {
"taxId": "2342",
"scientificName": "Candidatus Sodalis pierantonii str. SOPE",
"fullName": "Candidatus Sodalis pierantonii str. SOPE"
},
"name": "Flagellar transcriptional regulator FlhC",
"description": [
"Functions in complex with FlhD as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways"
],
"length": 196,
"sequence": "MYRKSIMQESRDIQLAMELIALGARLPILENETCLSRSRLLRLYKEVKGTPAPKGLLPFSADWFLSWEQNIHSSAFYNAYLCLIRIGNIPTIEAMIKAYRLYLELCPQRQDGGPVLGLTRAWILLRFIDSQLLGQTRCKQCGGAFITYAFHPPHNFVCSFCHPPSRAVKKRKLSHAAADNRIYNLRQRNMCNVKPC",
"proteome": "UP000019025",
"gene": "flhC1",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045893",
"name": "positive regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1902208",
"name": "regulation of bacterial-type flagellum assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "008ce0a2c5e07bf6b99133e35e31aae00b657478",
"counters": {
"domain_architectures": 3512,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3512
}
}
}