"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W0HLW2"	"{'domain_architectures': 3512, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3512}"	"['Functions in complex with FlhD as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways']"	"flhC1"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0045893', 'name': 'positive regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:1902208', 'name': 'regulation of bacterial-type flagellum assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"W0HLW2_9GAMM"	"008ce0a2c5e07bf6b99133e35e31aae00b657478"	True	False	False	196	"Flagellar transcriptional regulator FlhC"	3	"UP000019025"	"MYRKSIMQESRDIQLAMELIALGARLPILENETCLSRSRLLRLYKEVKGTPAPKGLLPFSADWFLSWEQNIHSSAFYNAYLCLIRIGNIPTIEAMIKAYRLYLELCPQRQDGGPVLGLTRAWILLRFIDSQLLGQTRCKQCGGAFITYAFHPPHNFVCSFCHPPSRAVKKRKLSHAAADNRIYNLRQRNMCNVKPC"	"unreviewed"	"{'taxId': '2342', 'scientificName': 'Candidatus Sodalis pierantonii str. SOPE', 'fullName': 'Candidatus Sodalis pierantonii str. SOPE'}"