General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "W0HHK9",
        "id": "W0HHK9_9GAMM",
        "source_organism": {
            "taxId": "2342",
            "scientificName": "Candidatus Sodalis pierantonii str. SOPE",
            "fullName": "Candidatus Sodalis pierantonii str. SOPE"
        },
        "name": "Outer membrane protein assembly factor BamD",
        "description": [
            "Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamA, the core component of the assembly machinery"
        ],
        "length": 243,
        "sequence": "MMRMKYLVAAATLSLVLAGCSSNKDAVPDNPPSEIYASAQQKLQDGNYKGAIKELEALDNRYPFGPYAQQVQLDLIYAYYKSADLPLAQASIDRFLRLNPTHPNVDYVLYMRGLTDMALDDSTLQGFFGVDRSDRNPEHARAAFRDFTQLIRGYPNSQYAMDATKRLVYLKDRLAKHELSVVEYYNKRGAYVAVANRVEQMLRDFPDTQATRQALPYMEKAYRELQLNGQADKVTKIIASNPA",
        "proteome": "UP000019025",
        "gene": "bamD",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0bb092d5fe92a9a842f748103c06d8d7ac5df2de",
        "counters": {
            "domain_architectures": 13337,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13337
        }
    }
}