"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"W0HHK9"	"{'domain_architectures': 13337, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'cdd': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 13337}"	"['Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamA, the core component of the assembly machinery']"	"bamD"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"W0HHK9_9GAMM"	"0bb092d5fe92a9a842f748103c06d8d7ac5df2de"	True	False	False	243	"Outer membrane protein assembly factor BamD"	3	"UP000019025"	"MMRMKYLVAAATLSLVLAGCSSNKDAVPDNPPSEIYASAQQKLQDGNYKGAIKELEALDNRYPFGPYAQQVQLDLIYAYYKSADLPLAQASIDRFLRLNPTHPNVDYVLYMRGLTDMALDDSTLQGFFGVDRSDRNPEHARAAFRDFTQLIRGYPNSQYAMDATKRLVYLKDRLAKHELSVVEYYNKRGAYVAVANRVEQMLRDFPDTQATRQALPYMEKAYRELQLNGQADKVTKIIASNPA"	"unreviewed"	"{'taxId': '2342', 'scientificName': 'Candidatus Sodalis pierantonii str. SOPE', 'fullName': 'Candidatus Sodalis pierantonii str. SOPE'}"