HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "T1H9E1",
"id": "T1H9E1_RHOPR",
"source_organism": {
"taxId": "13249",
"scientificName": "Rhodnius prolixus",
"fullName": "Rhodnius prolixus (Triatomid bug)"
},
"name": "Cytosol aminopeptidase",
"description": [
"Cytosolic metallopeptidase that catalyzes the removal of unsubstituted N-terminal hydrophobic amino acids from various peptides. The presence of Zn(2+) ions is essential for the peptidase activity, and the association with other cofactors can modulate the substrate spectificity of the enzyme. For instance, in the presence of Mn(2+), it displays a specific Cys-Gly hydrolyzing activity of Cys-Gly-S-conjugates. Involved in the metabolism of glutathione and in the degradation of glutathione S-conjugates, which may play a role in the control of the cell redox status"
],
"length": 426,
"sequence": "GKNVIVAGLGKRDEWDENKELNIGGKIYCELSRLKIKQAAISIEGNAANVAYGAFLRSFKFDKYKTKKDEKVTEVEEITVLAKDEQFSSAEKSFKCLRQEGEGIFLARALTTEPPNVLYPESYADYIKTELTKLGLEIEVLGKKQMEEKKMGALLGVAQGSSKEPKLVVIKWNGASKEQKPVAFVGKGITFDTGGVSLKPSRGMESMKYDMAGSATVVGVMRTLTGRKAKVNAIGVVALAENAVDGNAQRPSDVVTSMSGQTIEVLNTDAEGRLILADALWYTQNRFSPKFMVDLATLTGAIVVALGNNEYAGLFSNNDELVNRLTNAGNEVNEKLWRFPMNETYDKIIDSPIADVQNIAPAGSGGDSIMAAQFLQRFVNETCWAHLDIAGTAWHEKGTDISPKGAVGFGIRLLNKLVEKYYETGN",
"proteome": "UP000015103",
"gene": null,
"go_terms": [
{
"identifier": "GO:0030145",
"name": "manganese ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0070006",
"name": "metalloaminopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019538",
"name": "protein metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e69a2aa28cd056abaf8be0fdbafffbba4d7d13d",
"counters": {
"domain_architectures": 22296,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"pfam": 2,
"ssf": 2,
"ncbifam": 4,
"hamap": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22296
}
}
}