GET /api/protein/UniProt/S9XAM5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "S9XAM5",
"id": "S9XAM5_SCHCR",
"source_organism": {
"taxId": "653667",
"scientificName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)",
"fullName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)"
},
"name": "Altered inheritance of mitochondria protein 41",
"description": null,
"length": 119,
"sequence": "MQSLLRTRLYSISFKYRSFATNNVMPALQSEIRKKLMESMRNKDKKQSSTIKLFLSEIEIANKSNRPVTNDSEVIRLLKKSIKKKKQAIEQFLSANRTDLSDKEKVEIEILQKFLPRDS",
"proteome": "UP000015464",
"gene": "AIM41",
"go_terms": [
{
"identifier": "GO:0016884",
"name": "carbon-nitrogen ligase activity, with glutamine as amido-N-donor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0da641858f354ef4cdd6b765a6c689bceec31ba8",
"counters": {
"domain_architectures": 19805,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19805
}
}
}