General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S9XAM5",
        "id": "S9XAM5_SCHCR",
        "source_organism": {
            "taxId": "653667",
            "scientificName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)",
            "fullName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)"
        },
        "name": "Altered inheritance of mitochondria protein 41",
        "description": null,
        "length": 119,
        "sequence": "MQSLLRTRLYSISFKYRSFATNNVMPALQSEIRKKLMESMRNKDKKQSSTIKLFLSEIEIANKSNRPVTNDSEVIRLLKKSIKKKKQAIEQFLSANRTDLSDKEKVEIEILQKFLPRDS",
        "proteome": "UP000015464",
        "gene": "AIM41",
        "go_terms": [
            {
                "identifier": "GO:0016884",
                "name": "carbon-nitrogen ligase activity, with glutamine as amido-N-donor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0da641858f354ef4cdd6b765a6c689bceec31ba8",
        "counters": {
            "domain_architectures": 19805,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19805
        }
    }
}