"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S9XAM5"	"{'domain_architectures': 19805, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 19805}"	""	"AIM41"	"[{'identifier': 'GO:0016884', 'name': 'carbon-nitrogen ligase activity, with glutamine as amido-N-donor', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"S9XAM5_SCHCR"	"0da641858f354ef4cdd6b765a6c689bceec31ba8"	True	False	False	119	"Altered inheritance of mitochondria protein 41"	3	"UP000015464"	"MQSLLRTRLYSISFKYRSFATNNVMPALQSEIRKKLMESMRNKDKKQSSTIKLFLSEIEIANKSNRPVTNDSEVIRLLKKSIKKKKQAIEQFLSANRTDLSDKEKVEIEILQKFLPRDS"	"unreviewed"	"{'taxId': '653667', 'scientificName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)', 'fullName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)'}"