GET /api/protein/UniProt/S9W4V6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S9W4V6",
        "id": "S9W4V6_SCHCR",
        "source_organism": {
            "taxId": "653667",
            "scientificName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)",
            "fullName": "Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)"
        },
        "name": "mRNA decapping complex regulatory subunit Dcp1",
        "description": null,
        "length": 126,
        "sequence": "MEDEEILRDAVNLQVLKFHYPTITSTIDIASHVAVYQFDIPSQQWVKTAIEGTFFLVKDQFARIGYVILNRNSPENLYLFVDNPQNVHLVDRYLIHKLRDHQVVGLWMFDPNDMNRIYNRISHHKF",
        "proteome": "UP000015464",
        "gene": "SPOG_04624",
        "go_terms": [
            {
                "identifier": "GO:0008047",
                "name": "enzyme activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000290",
                "name": "deadenylation-dependent decapping of nuclear-transcribed mRNA",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043085",
                "name": "positive regulation of catalytic activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5b3b0b8bc9364040aa4fcea2312610becbdfe911",
        "counters": {
            "domain_architectures": 3933,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3933
        }
    }
}