"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S9W4V6"	"{'domain_architectures': 3933, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3933}"	""	"SPOG_04624"	"[{'identifier': 'GO:0008047', 'name': 'enzyme activator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000290', 'name': 'deadenylation-dependent decapping of nuclear-transcribed mRNA', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043085', 'name': 'positive regulation of catalytic activity', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"S9W4V6_SCHCR"	"5b3b0b8bc9364040aa4fcea2312610becbdfe911"	True	False	False	126	"mRNA decapping complex regulatory subunit Dcp1"	3	"UP000015464"	"MEDEEILRDAVNLQVLKFHYPTITSTIDIASHVAVYQFDIPSQQWVKTAIEGTFFLVKDQFARIGYVILNRNSPENLYLFVDNPQNVHLVDRYLIHKLRDHQVVGLWMFDPNDMNRIYNRISHHKF"	"unreviewed"	"{'taxId': '653667', 'scientificName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691)', 'fullName': 'Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast)'}"
