General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S8AJ29",
        "id": "S8AJ29_PENO1",
        "source_organism": {
            "taxId": "933388",
            "scientificName": "Penicillium oxalicum (strain 114-2 / CGMCC 5302)",
            "fullName": "Penicillium oxalicum (strain 114-2 / CGMCC 5302)"
        },
        "name": "NADH-ubiquinone oxidoreductase",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 159,
        "sequence": "MAQRDPQFNQHVLVDTTPMPDHIPKVEEIGATSAYLTSAAYFIGDRCKAFNDDFMKCKDEANGRGEIECLKEGRKVTRCAASVIKDINTHCLDQFKAHADCLENNNHYLFECRKAEVSLNSCIFDKLGLKKTIPGAPENQVPVHLRPKQKYAQYPGPQY",
        "proteome": "UP000019376",
        "gene": "PDE_00714",
        "go_terms": [
            {
                "identifier": "GO:0006120",
                "name": "mitochondrial electron transport, NADH to ubiquinone",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}