"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S8AJ29"	"{'domain_architectures': 0, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pirsf': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"PDE_00714"	"[{'identifier': 'GO:0006120', 'name': 'mitochondrial electron transport, NADH to ubiquinone', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"S8AJ29_PENO1"	""	True	False	False	159	"NADH-ubiquinone oxidoreductase"	3	"UP000019376"	"MAQRDPQFNQHVLVDTTPMPDHIPKVEEIGATSAYLTSAAYFIGDRCKAFNDDFMKCKDEANGRGEIECLKEGRKVTRCAASVIKDINTHCLDQFKAHADCLENNNHYLFECRKAEVSLNSCIFDKLGLKKTIPGAPENQVPVHLRPKQKYAQYPGPQY"	"unreviewed"	"{'taxId': '933388', 'scientificName': 'Penicillium oxalicum (strain 114-2 / CGMCC 5302)', 'fullName': 'Penicillium oxalicum (strain 114-2 / CGMCC 5302)'}"