GET /api/protein/UniProt/S4ZM86/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S4ZM86",
        "id": "S4ZM86_LACPA",
        "source_organism": {
            "taxId": "1597",
            "scientificName": "Lacticaseibacillus paracasei",
            "fullName": "Lacticaseibacillus paracasei"
        },
        "name": "ADP-dependent (S)-NAD(P)H-hydrate dehydratase",
        "description": [
            "Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration"
        ],
        "length": 273,
        "sequence": "MKQLTEQFAQSVVRPRARDTYKGSFGKILIVGGNAHFGGAAIMSASAAVYAGAGLVSVATDPVNRHALHARLPEAMILDATAPELETAVRQATVIVVGPGLGTDGTALTILKTVFAAVNAKQVMIIDGSAITLVASHHLDYPQAQLIWTPHQIEWQRLSGLPLAAQTIEASQKAAAKIPGIIVAKSSHTHVFVDEDVYENTAGGPAMATGGSGDTLTGIIAAFAGQFQPLDKAALAAVFVHSRVADIVAMNSYVALPTMVIRELPTYLKQLSE",
        "proteome": null,
        "gene": "nnrD",
        "go_terms": [
            {
                "identifier": "GO:0016836",
                "name": "hydro-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eb2397caca8f7fa889594e54b5b9ecc04f2946b7",
        "counters": {
            "domain_architectures": 11024,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 11024
        }
    }
}