"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S4ZM86"	"{'domain_architectures': 11024, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'prosite': 2, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 11024}"	"['Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration']"	"nnrD"	"[{'identifier': 'GO:0016836', 'name': 'hydro-lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"S4ZM86_LACPA"	"eb2397caca8f7fa889594e54b5b9ecc04f2946b7"	True	False	False	273	"ADP-dependent (S)-NAD(P)H-hydrate dehydratase"	3	""	"MKQLTEQFAQSVVRPRARDTYKGSFGKILIVGGNAHFGGAAIMSASAAVYAGAGLVSVATDPVNRHALHARLPEAMILDATAPELETAVRQATVIVVGPGLGTDGTALTILKTVFAAVNAKQVMIIDGSAITLVASHHLDYPQAQLIWTPHQIEWQRLSGLPLAAQTIEASQKAAAKIPGIIVAKSSHTHVFVDEDVYENTAGGPAMATGGSGDTLTGIIAAFAGQFQPLDKAALAAVFVHSRVADIVAMNSYVALPTMVIRELPTYLKQLSE"	"unreviewed"	"{'taxId': '1597', 'scientificName': 'Lacticaseibacillus paracasei', 'fullName': 'Lacticaseibacillus paracasei'}"
