GET /api/protein/UniProt/S0DRD7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "S0DRD7",
        "id": "S0DRD7_GIBF5",
        "source_organism": {
            "taxId": "1279085",
            "scientificName": "Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)",
            "fullName": "Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus)"
        },
        "name": "L-arabinitol 4-dehydrogenase",
        "description": [
            "Xylitol dehydrogenase which catalyzes the conversion of xylitol to D-xylulose. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway"
        ],
        "length": 353,
        "sequence": "MASNLSFVLNKPNDVSFEERPKPTLSSPHDVLVAVNYTGICGSDVHYWVHGSIGKFVVEDPMVLGHESAGTIVEVGSKVKTLKVGDRVALEPGYPCRRCQNCLAGKYNLCPDMVFAATPPYHGTLTGYWTAPADFCFKLPDNVSQQEGALIEPLAVAVHIVKQARVKPGDSVVVMGAGPVGLLCAAVAKAYGASKIVSVDIVQSKLDFAKDFASTHVYASQRIAPEENAKNICELADLPEGADVVIDASGAEPSIQASIHVLKNGGSYVQGGMGKADITFPIMAFCIKEATASGSFRYGAGDYPLAVELVATGKVDVKKLITGVVEFKQAEEAFKKVKEGEAIKVLIKGPNEQ",
        "proteome": "UP000016800",
        "gene": "FFUJ_03844",
        "go_terms": [
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6e6b076d581cf5733167d9dad5b9a31c66e6d8d3",
        "counters": {
            "domain_architectures": 323634,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "smart": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 323634
        }
    }
}