"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"S0DRD7"	"{'domain_architectures': 323634, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cdd': 1, 'smart': 1, 'cathgene3d': 2, 'pfam': 2, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 323634}"	"['Xylitol dehydrogenase which catalyzes the conversion of xylitol to D-xylulose. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway']"	"FFUJ_03844"	"[{'identifier': 'GO:0016616', 'name': 'oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"S0DRD7_GIBF5"	"6e6b076d581cf5733167d9dad5b9a31c66e6d8d3"	True	False	False	353	"L-arabinitol 4-dehydrogenase"	3	"UP000016800"	"MASNLSFVLNKPNDVSFEERPKPTLSSPHDVLVAVNYTGICGSDVHYWVHGSIGKFVVEDPMVLGHESAGTIVEVGSKVKTLKVGDRVALEPGYPCRRCQNCLAGKYNLCPDMVFAATPPYHGTLTGYWTAPADFCFKLPDNVSQQEGALIEPLAVAVHIVKQARVKPGDSVVVMGAGPVGLLCAAVAKAYGASKIVSVDIVQSKLDFAKDFASTHVYASQRIAPEENAKNICELADLPEGADVVIDASGAEPSIQASIHVLKNGGSYVQGGMGKADITFPIMAFCIKEATASGSFRYGAGDYPLAVELVATGKVDVKKLITGVVEFKQAEEAFKKVKEGEAIKVLIKGPNEQ"	"unreviewed"	"{'taxId': '1279085', 'scientificName': 'Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)', 'fullName': 'Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus)'}"
