GET /api/protein/UniProt/Q9Z6V7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9Z6V7",
        "id": "RL25_CHLPN",
        "source_organism": {
            "taxId": "83558",
            "scientificName": "Chlamydia pneumoniae",
            "fullName": "Chlamydia pneumoniae"
        },
        "name": "Large ribosomal subunit protein bL25",
        "description": [
            "This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance"
        ],
        "length": 185,
        "sequence": "MELVVTSRETGKKSFLKKIRQQGGIPAVVYSAGKSLANITVDALVFKKFLSNLESGALSSTVFSLSYEGRIIKALVKDIQYQITTYDVIHLDFEELVEDRPVKLNIPIRCINAVDCIGVKLGGSLRQVIRAVRVVCKPKDIVPFLELDVRSVGLSQTRKLSDIKIPAGIETITPLKEVAITVSRR",
        "proteome": "UP000000424",
        "gene": "rplY",
        "go_terms": [
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008097",
                "name": "5S rRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "18556c84677b41f4736214af61f86e05d0794439",
        "counters": {
            "domain_architectures": 21163,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21163
        }
    }
}