"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9Z6V7"	"{'domain_architectures': 21163, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'pfam': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 2, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 21163}"	"['This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance']"	"rplY"	"[{'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0008097', 'name': '5S rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RL25_CHLPN"	"18556c84677b41f4736214af61f86e05d0794439"	True	False	False	185	"Large ribosomal subunit protein bL25"	3	"UP000000424"	"MELVVTSRETGKKSFLKKIRQQGGIPAVVYSAGKSLANITVDALVFKKFLSNLESGALSSTVFSLSYEGRIIKALVKDIQYQITTYDVIHLDFEELVEDRPVKLNIPIRCINAVDCIGVKLGGSLRQVIRAVRVVCKPKDIVPFLELDVRSVGLSQTRKLSDIKIPAGIETITPLKEVAITVSRR"	"reviewed"	"{'taxId': '83558', 'scientificName': 'Chlamydia pneumoniae', 'fullName': 'Chlamydia pneumoniae'}"
