HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9Y5K5",
"id": "UCHL5_HUMAN",
"source_organism": {
"taxId": "9606",
"scientificName": "Homo sapiens",
"fullName": "Homo sapiens (Human)"
},
"name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5",
"description": [
"Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1"
],
"length": 329,
"sequence": "MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK",
"proteome": "UP000005640",
"gene": "UCHL5",
"go_terms": [
{
"identifier": "GO:0004843",
"name": "cysteine-type deubiquitinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006511",
"name": "ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070628",
"name": "proteasome binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016579",
"name": "protein deubiquitination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0031011",
"name": "Ino80 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8ee7d6d4c7be4bc8b88c097d3270df4c9225d658",
"counters": {
"domain_architectures": 5948,
"entries": 17,
"isoforms": 4,
"proteomes": 1,
"sets": 3,
"structures": 11,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"profile": 2,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5948
}
}
}