General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9TUC5",
        "id": "SFTPA_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "Pulmonary surfactant-associated protein A",
        "description": [
            "In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages"
        ],
        "length": 248,
        "sequence": "MWLCPLALTLTLMAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGDMPCFPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQESILAIGGKVFSTNGQSATFDAIQEACARAGGHIAVPRSPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYPGEPAGRGTEQCVEMYTDGRWNDRNCLYNRLTICEF",
        "proteome": "UP000006718",
        "gene": "SFTPA1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1cc9d00484b728ff431ced75fc3bb394a7e71b41",
        "counters": {
            "domain_architectures": 71987,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 71987
        }
    }
}