"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9TUC5"	"{'domain_architectures': 71987, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 2, 'smart': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 71987}"	"['In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages']"	"SFTPA1"	""	"SFTPA_MACMU"	"1cc9d00484b728ff431ced75fc3bb394a7e71b41"	True	False	False	248	"Pulmonary surfactant-associated protein A"	2	"UP000006718"	"MWLCPLALTLTLMAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGDMPCFPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQESILAIGGKVFSTNGQSATFDAIQEACARAGGHIAVPRSPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYPGEPAGRGTEQCVEMYTDGRWNDRNCLYNRLTICEF"	"reviewed"	"{'taxId': '9544', 'scientificName': 'Macaca mulatta', 'fullName': 'Macaca mulatta (Rhesus macaque)'}"
