General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9PN78",
        "id": "PURNU_CAMJE",
        "source_organism": {
            "taxId": "192222",
            "scientificName": "Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)",
            "fullName": "Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)"
        },
        "name": "Purine nucleoside phosphorylase Cj1217c",
        "description": [
            "Purine nucleoside enzyme that catalyzes the phosphorolysis of adenosine and inosine nucleosides, yielding D-ribose 1-phosphate and the respective free bases, adenine and hypoxanthine. Also catalyzes the phosphorolysis of S-methyl-5'-thioadenosine into adenine and S-methyl-5-thio-alpha-D-ribose 1-phosphate. Also has adenosine deaminase activity"
        ],
        "length": 226,
        "sequence": "MGRSRKNFLSLLENDKVGIFCAFDKDYNVFRAKIHNENLFSHLGFKDIEKCVFMDQIHSHKVIIYDENLKNLSCDGLISKEKNIALCVLSADCLPLILYHESGIIAALHSGRKGSFENILKECVDQITMQNSHLDKNKFHLFILPGICAKNYEIDGEILEFAKKEFKEFVQDDKLDLKALVKFQAQNLGIENIKDCGICSFDDESFFSYRRDKTTKRFVSVVYLKD",
        "proteome": "UP000000799",
        "gene": "Cj1217c",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a9e1b29108c23de2c131028b981fdf08358aa59f",
        "counters": {
            "domain_architectures": 22098,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22098
        }
    }
}