"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9PN78"	"{'domain_architectures': 22098, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22098}"	"[""Purine nucleoside enzyme that catalyzes the phosphorolysis of adenosine and inosine nucleosides, yielding D-ribose 1-phosphate and the respective free bases, adenine and hypoxanthine. Also catalyzes the phosphorolysis of S-methyl-5'-thioadenosine into adenine and S-methyl-5-thio-alpha-D-ribose 1-phosphate. Also has adenosine deaminase activity""]"	"Cj1217c"	""	"PURNU_CAMJE"	"a9e1b29108c23de2c131028b981fdf08358aa59f"	True	False	False	226	"Purine nucleoside phosphorylase Cj1217c"	3	"UP000000799"	"MGRSRKNFLSLLENDKVGIFCAFDKDYNVFRAKIHNENLFSHLGFKDIEKCVFMDQIHSHKVIIYDENLKNLSCDGLISKEKNIALCVLSADCLPLILYHESGIIAALHSGRKGSFENILKECVDQITMQNSHLDKNKFHLFILPGICAKNYEIDGEILEFAKKEFKEFVQDDKLDLKALVKFQAQNLGIENIKDCGICSFDDESFFSYRRDKTTKRFVSVVYLKD"	"reviewed"	"{'taxId': '192222', 'scientificName': 'Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)', 'fullName': 'Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)'}"