GET /api/protein/UniProt/Q9I970/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9I970",
        "id": "Q9I970_ONCMY",
        "source_organism": {
            "taxId": "8022",
            "scientificName": "Oncorhynchus mykiss",
            "fullName": "Oncorhynchus mykiss (Rainbow trout)"
        },
        "name": "Lymphotoxin-alpha",
        "description": [
            "Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo"
        ],
        "length": 246,
        "sequence": "MEGYAMTPEDMERGPVYNTTVTAVAEGKASRGWLWRLCGVLLIAGLCAAAALLFAWCQHGRPSTMQDEIEPQLEILIGAKDTHHTLKQIAGNAKAAIHLEGEYNPNLSADTVQWRKDDGQAFSQGGFELQGNQILIPHTGLFFVYSQASFRVKCNSPGEHTTPLSHIIWRYSDSIGVNANLLSGVRSVCQQNYGDAESKIGEGWYNAVYLGAVFQLNEGDKLWTETNRLTDVEPEQGKNFFGVFAL",
        "proteome": null,
        "gene": "tnfa",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005164",
                "name": "tumor necrosis factor receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "452ab3949debfc11bfeb581670598a02215fe991",
        "counters": {
            "domain_architectures": 12863,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12863
        }
    }
}