General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9I2C1",
        "id": "PQQD_PSEAE",
        "source_organism": {
            "taxId": "208964",
            "scientificName": "Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)",
            "fullName": "Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)"
        },
        "name": "PqqA binding protein",
        "description": [
            "Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway"
        ],
        "length": 92,
        "sequence": "MSLPSLDSVPMLRRGFRFQFEPAQDCHVLLYPEGMVKLNDSAGEILKLVDGRRDVAAIVAALRERFPEVPGIDEDILAFLEVAHAQFWIELQ",
        "proteome": "UP000002438",
        "gene": "pqqD",
        "go_terms": [
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0018189",
                "name": "pyrroloquinoline quinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cf4c228ea0558b5123ee962cb98aba0737bc7305",
        "counters": {
            "domain_architectures": 11077,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11077
        }
    }
}