"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9I2C1"	"{'domain_architectures': 11077, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'hamap': 1, 'ncbifam': 2, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 11077}"	"['Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway']"	"pqqD"	"[{'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0018189', 'name': 'pyrroloquinoline quinone biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"PQQD_PSEAE"	"cf4c228ea0558b5123ee962cb98aba0737bc7305"	True	False	False	92	"PqqA binding protein"	3	"UP000002438"	"MSLPSLDSVPMLRRGFRFQFEPAQDCHVLLYPEGMVKLNDSAGEILKLVDGRRDVAAIVAALRERFPEVPGIDEDILAFLEVAHAQFWIELQ"	"reviewed"	"{'taxId': '208964', 'scientificName': 'Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)', 'fullName': 'Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)'}"