General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9GNV2",
        "id": "TWIST_PODCA",
        "source_organism": {
            "taxId": "6096",
            "scientificName": "Podocoryna carnea",
            "fullName": "Podocoryna carnea (Hydrozoan)"
        },
        "name": "Twist-related protein",
        "description": [
            "Probable transcription factor, which may be responsible for the formation of myoepithelial cells in early muscle development in larva and the formation of non-muscle tissues in later bud stages and mesoderm-like structures in the medusa"
        ],
        "length": 199,
        "sequence": "MQEHQLSRVTSGNKKKYQSFDDESRDEKRMKCDSTDKLESNSNSKNIYQKTHRVIANIRERQRTQALNQSFSTLRKIIPTLPSDKLSKIQTLRLAAMYIDFLRHVIRRGEINMDSSDETFFSAQERLSYAFSVWRMEGDFYSRDKTAHYFTEQELNLCEYNFHSSFGNRLFYKAGIEAVNSADSDDITCILNTFLEGRI",
        "proteome": null,
        "gene": "TWIST",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15b86a07eaabcbc71b6ebb705399c8a22c21f484",
        "counters": {
            "domain_architectures": 146351,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 146351
        }
    }
}