"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9GNV2"	"{'domain_architectures': 146351, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 146351}"	"['Probable transcription factor, which may be responsible for the formation of myoepithelial cells in early muscle development in larva and the formation of non-muscle tissues in later bud stages and mesoderm-like structures in the medusa']"	"TWIST"	"[{'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"TWIST_PODCA"	"15b86a07eaabcbc71b6ebb705399c8a22c21f484"	True	False	False	199	"Twist-related protein"	2	""	"MQEHQLSRVTSGNKKKYQSFDDESRDEKRMKCDSTDKLESNSNSKNIYQKTHRVIANIRERQRTQALNQSFSTLRKIIPTLPSDKLSKIQTLRLAAMYIDFLRHVIRRGEINMDSSDETFFSAQERLSYAFSVWRMEGDFYSRDKTAHYFTEQELNLCEYNFHSSFGNRLFYKAGIEAVNSADSDDITCILNTFLEGRI"	"reviewed"	"{'taxId': '6096', 'scientificName': 'Podocoryna carnea', 'fullName': 'Podocoryna carnea (Hydrozoan)'}"