General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9FK25",
        "id": "OMT1_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Flavone 3'-O-methyltransferase 1",
        "description": [
            "Methylates OH residues of flavonoid compounds. Converts quercetin into isorhamnetin. Dihydroquercetin is not a substrate. Catalyzes the methylation of monolignols, the lignin precursors. Does not contribute to the phenylpropanoid pattern of the pollen tryphine, but is probably confined to isorhamnetin glycoside biosynthesis (PubMed:10700397, PubMed:12777055, PubMed:20652169, PubMed:22258746). Involved in melatonin biosynthesis (PubMed:25039887, PubMed:25250906, PubMed:32354877). Functions as an acetylserotonin O-methyltransferase that catalyzes the transfer of a methyl group onto N-acetylserotonin (NAS), producing melatonin (N-acetyl-5-methoxytryptamine) (PubMed:25039887, PubMed:25250906). Can also methylate serotonin into 5-methoxytryptamine (5-MT) with low catalytic activity (PubMed:25250906). Implicated in melatonin-dependent circadian dynamics of stomatal aperture to minimize night water loss and promote drought tolerance (PubMed:32064655). Prevents the accumulation of oil and anthocyanin content in mature seeds, as well as mucilage production in the seed coat, in a melatonin-dependent manner (PubMed:32354877)"
        ],
        "length": 363,
        "sequence": "MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGSPMSPTEIASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLKKL",
        "proteome": "UP000006548",
        "gene": "OMT1",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008171",
                "name": "O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bdc835ccb83003619dd55371e507d9b3256eafa8",
        "counters": {
            "domain_architectures": 30676,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30676
        }
    }
}