GET /api/protein/UniProt/Q9D9W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9D9W1",
        "id": "CMAP3_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Ciliary microtubule-associated protein 3",
        "description": [
            "During primary cilia disassembly, involved in cilia disassembly. Required specifically to control cilia retraction as well as the liberation and duplication of the basal body/centrosome. May act by stimulating AURKA activity at the basal body in a cell cycle-dependent manner"
        ],
        "length": 207,
        "sequence": "MNTEEIPVAPPLRGVTPALQWKVNNYSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYPGMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSYPGPGTYNPEMKSVPKVTWPMKFGSPDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYYQ",
        "proteome": "UP000000589",
        "gene": "Cimap3",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "325db420dd76a62731cb5e339834568668e4421b",
        "counters": {
            "domain_architectures": 2468,
            "entries": 4,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2468
        }
    }
}