GET /api/protein/UniProt/Q9D9W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q9D9W1",
"id": "CMAP3_MOUSE",
"source_organism": {
"taxId": "10090",
"scientificName": "Mus musculus",
"fullName": "Mus musculus (Mouse)"
},
"name": "Ciliary microtubule-associated protein 3",
"description": [
"During primary cilia disassembly, involved in cilia disassembly. Required specifically to control cilia retraction as well as the liberation and duplication of the basal body/centrosome. May act by stimulating AURKA activity at the basal body in a cell cycle-dependent manner"
],
"length": 207,
"sequence": "MNTEEIPVAPPLRGVTPALQWKVNNYSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYPGMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSYPGPGTYNPEMKSVPKVTWPMKFGSPDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYYQ",
"proteome": "UP000000589",
"gene": "Cimap3",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "325db420dd76a62731cb5e339834568668e4421b",
"counters": {
"domain_architectures": 2468,
"entries": 4,
"isoforms": 2,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2468
}
}
}