"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9D9W1"	"{'domain_architectures': 2468, 'entries': 4, 'isoforms': 2, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2468}"	"['During primary cilia disassembly, involved in cilia disassembly. Required specifically to control cilia retraction as well as the liberation and duplication of the basal body/centrosome. May act by stimulating AURKA activity at the basal body in a cell cycle-dependent manner']"	"Cimap3"	""	"CMAP3_MOUSE"	"325db420dd76a62731cb5e339834568668e4421b"	True	False	False	207	"Ciliary microtubule-associated protein 3"	1	"UP000000589"	"MNTEEIPVAPPLRGVTPALQWKVNNYSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYPGMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSYPGPGTYNPEMKSVPKVTWPMKFGSPDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYYQ"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"