General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q99380",
        "id": "OST4_YEAST",
        "source_organism": {
            "taxId": "559292",
            "scientificName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
            "fullName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)"
        },
        "name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4",
        "description": [
            "Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity"
        ],
        "length": 36,
        "sequence": "MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN",
        "proteome": "UP000002311",
        "gene": "OST4",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fbc681a69ca5982e51f05e6d657961ce8d4563eb",
        "counters": {
            "domain_architectures": 1823,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 9,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1823
        }
    }
}