"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q99380"	"{'domain_architectures': 1823, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 9, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1823}"	"['Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity']"	"OST4"	""	"OST4_YEAST"	"fbc681a69ca5982e51f05e6d657961ce8d4563eb"	True	False	False	36	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4"	1	"UP000002311"	"MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN"	"reviewed"	"{'taxId': '559292', 'scientificName': 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)', 'fullName': ""Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)""}"