General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q97ZK4",
        "id": "RS34_SACS2",
        "source_organism": {
            "taxId": "273057",
            "scientificName": "Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)",
            "fullName": "Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)"
        },
        "name": "Small ribosomal subunit protein aS34",
        "description": [
            "Component of the small ribosomal subunit (PubMed:39753558). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed:39753558). Binds 16S (small) rRNA (PubMed:39753558)"
        ],
        "length": 72,
        "sequence": "MSIKNRGSNAYGHLGWLTVYCRICNRKLIIGTDILYKCPKCEKKYSAYFCEADKRGLKGKCPYCGTELVPIL",
        "proteome": "UP000001974",
        "gene": "rps34a",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 0,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 8,
            "taxa": 1,
            "dbEntries": {},
            "proteome": 1,
            "taxonomy": 1
        }
    }
}