"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q97ZK4"	"{'domain_architectures': 0, 'entries': 0, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 8, 'taxa': 1, 'dbEntries': {}, 'proteome': 1, 'taxonomy': 1}"	"['Component of the small ribosomal subunit (PubMed:39753558). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed:39753558). Binds 16S (small) rRNA (PubMed:39753558)']"	"rps34a"	""	"RS34_SACS2"	""	True	False	False	72	"Small ribosomal subunit protein aS34"	1	"UP000001974"	"MSIKNRGSNAYGHLGWLTVYCRICNRKLIIGTDILYKCPKCEKKYSAYFCEADKRGLKGKCPYCGTELVPIL"	"reviewed"	"{'taxId': '273057', 'scientificName': 'Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)', 'fullName': 'Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)'}"